PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.249860.1
Common NameCsa_2G302300, LOC101218795
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 211aa    MW: 23544.4 Da    PI: 10.9455
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.249860.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-172772147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l ++v+q+G+ +W+ Ia+++  gR++k+c++rw++ 
   Cucsa.249860.1 27 RGHWRPAEDNKLRQLVEQFGPQNWNYIAEHFE-GRSGKSCRLRWYNQ 72
                     899*****************************.************96 PP

2Myb_DNA-binding51.22.8e-1679122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++++eE+e+l+   +++G++ W++Iar++  gRt++ +k++++ 
   Cucsa.249860.1  79 KNPFSEEEEERLLMFQQLHGNK-WALIARHFK-GRTDNAVKNHYHV 122
                      689*******************.********9.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576125No hitNo description
PROSITE profilePS5129422.4862277IPR017930Myb domain
SuperFamilySSF466898.99E-2925120IPR009057Homeodomain-like
SMARTSM007171.1E-132675IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-262880IPR009057Homeodomain-like
CDDcd001676.42E-133071No hitNo description
PfamPF139214.7E-183090No hitNo description
PROSITE profilePS5129417.23878128IPR017930Myb domain
SMARTSM007179.7E-1478126IPR001005SANT/Myb domain
CDDcd001674.25E-1081121No hitNo description
Gene3DG3DSA:1.10.10.609.2E-2081126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MMRSKSSSSS GGSSGGGGGS SGVSCYRGHW RPAEDNKLRQ LVEQFGPQNW NYIAEHFEGR  60
SGKSCRLRWY NQLDPNINKN PFSEEEEERL LMFQQLHGNK WALIARHFKG RTDNAVKNHY  120
HVIMARRRRE RFTIFTNHNK NNNTIRHSLL SFSKTTAAVK WTPLTAGAPV LLGNGRGKSS  180
LPAVVASGSG EGEDHKRRIP FIDFLGMGSS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-27271274104MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-27271274104C-Myb DNA-Binding Domain
1msf_C1e-27271274104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819120.0LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147366.11e-156PREDICTED: transcriptional activator Myb
TrEMBLA0A0A0LM981e-156A0A0A0LM98_CUCSA; Uncharacterized protein
STRINGPOPTR_0007s04140.17e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33450.13e-61myb domain protein 69
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]